DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and Atp5mc2

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_598240.1 Gene:Atp5mc2 / 171082 RGDID:620051 Length:141 Species:Rattus norvegicus


Alignment Length:130 Identity:30/130 - (23%)
Similarity:51/130 - (39%) Gaps:38/130 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGL 149
            ::.|::.|...:|     .:|:...:|:::.|   ..|.:..:..|....|..:..|.||     
  Rat    30 LKRPQMPTDEGLS-----CLAVRRPLTSLIPS---RSFQTSAISRDIDTAAKFIGAGAAT----- 81

  Fly   150 CVGMVNVACGIAVGIVGSGAALAD---------AANSALFVKILIVEIFG----SAIGLFGLIVA 201
                        ||:.||||.:..         |.|.:|..::....|.|    .|:|||.|:||
  Rat    82 ------------VGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVA 134

  Fly   202  201
              Rat   135  134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 14/80 (18%)
ATP-synt_C 143..204 CDD:278563 20/72 (28%)
Atp5mc2NP_598240.1 ATP9 67..141 CDD:164765 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.