DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and Atp6v0c

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001348460.1 Gene:Atp6v0c / 11984 MGIID:88116 Length:214 Species:Mus musculus


Alignment Length:152 Identity:52/152 - (34%)
Similarity:80/152 - (52%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVN 120
            ||...|...|.:|||.|....|..:|...|..|.:..|::|.|:....:|||||:.|:|::.:  
Mouse    76 MGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANS-- 138

  Fly   121 KFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILI 185
                   :||    ...::..|...||||.||:..:|.|.|:||||.......|....|||.:::
Mouse   139 -------LTD----GITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 192

  Fly   186 VEIFGSAIGLFGLIVAIYMTSK 207
            :.||...:||:|||||:.:::|
Mouse   193 ILIFAEVLGLYGLIVALILSTK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 36/109 (33%)
ATP-synt_C 143..204 CDD:278563 26/60 (43%)
Atp6v0cNP_001348460.1 V_ATP_synt_C 72..177 CDD:130170 38/113 (34%)
ATP-synt_C 152..211 CDD:306615 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.