DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and Atp6v0b

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_291095.1 Gene:Atp6v0b / 114143 MGIID:1890510 Length:205 Species:Mus musculus


Alignment Length:201 Identity:111/201 - (55%)
Similarity:145/201 - (72%) Gaps:5/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFFMLFVLGAASLGAVGIIFANVMVNMGERMGLGWFLYTSNPFLWSGMGIFLACALSVLGAASGI 73
            |:..:||...|.:..|||.:  .:.::|.|..:.|||..::||:||.:||.||.:|||:|||.||
Mouse     7 LYLGIFVAFWACMVVVGICY--TIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGI 69

  Fly    74 YMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMATNM 138
            |:.|.|:.||||::||||||||:|:||||||||||:|.||::|.....||:..   ...:...|.
Mouse    70 YITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATE---PKAIGHRNY 131

  Fly   139 FTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVAIY 203
            ..|::.|||||.||:.|:.||:.|||||||||||||.|.:|||||||||||||||||||:||||.
Mouse   132 HAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAIL 196

  Fly   204 MTSKAE 209
            .||:.:
Mouse   197 QTSRVK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 59/109 (54%)
ATP-synt_C 143..204 CDD:278563 47/60 (78%)
Atp6v0bNP_291095.1 ATP-synt_Vo_c_ATP6F_rpt1 49..111 CDD:349417 43/61 (70%)
ATP-synt_Vo_c_ATP6F_rpt2 133..197 CDD:349418 48/63 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833678
Domainoid 1 1.000 96 1.000 Domainoid score I7315
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S432
OMA 1 1.010 - - QHG53850
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.660

Return to query results.
Submit another query.