DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3817 and RRP15

DIOPT Version :9

Sequence 1:NP_650405.2 Gene:CG3817 / 41805 FlyBaseID:FBgn0038275 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_015469.1 Gene:RRP15 / 856264 SGDID:S000006347 Length:250 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:49/200 - (24%)
Similarity:100/200 - (50%) Gaps:37/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKTHAPASDSSPEESD----SEGSQNSASEAEGNAGWADSIQKVLKT-TKPKTQKKTVLARAKKS 69
            :::.|...|...||.|    .:.|:||..: :|:.|::.::..:|.: .|...:|..::||.|| 
Yeast    67 EQSDAEEDDDEEEEDDDFPRKKKSKNSKHD-DGSTGFSAAVNAILSSHLKAYDRKDPIMARNKK- 129

  Fly    70 QAAVRFQKDAANKKPGFDFEIEKADVKEEDE--GDNHE-DEKPQASALDATLTKQQRKNVPLQLR 131
                 ..|.:.::|  .:::.:||.:.|:.:  |...: |..|.||..|      :.:|:.    
Yeast   130 -----VLKQSESEK--LEYKAKKALLAEKKKLLGKARKTDIIPIASGED------RSENIR---- 177

  Fly   132 VKPSFRDMERERTLRKVATRGVVQFFNAVRIQQ----KDLQQQLEEAGPLDSRQDAVLNNINKRK 192
                 :.:|:|..|||:|.:|.|:.|||:...|    |::.:.|.|....:.::: ::..::|.|
Yeast   178 -----KVLEKETALRKIAQKGAVKLFNAILATQVKTEKEVSENLSEIKNKEEKKE-LITEVSKEK 236

  Fly   193 FLDVL 197
            |||::
Yeast   237 FLDLV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3817NP_650405.2 Rrp15p <105..198 CDD:285173 26/97 (27%)
RRP15NP_015469.1 Rrp15p 112..242 CDD:400306 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2974
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004819
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103633
Panther 1 1.100 - - LDO PTHR13245
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.