DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3817 and AT5G48240

DIOPT Version :9

Sequence 1:NP_650405.2 Gene:CG3817 / 41805 FlyBaseID:FBgn0038275 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001154769.1 Gene:AT5G48240 / 834877 AraportID:AT5G48240 Length:356 Species:Arabidopsis thaliana


Alignment Length:368 Identity:83/368 - (22%)
Similarity:123/368 - (33%) Gaps:148/368 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGNAGWAD--------SIQKVLKTTKPKTQK----------------KTVLARAK---------- 67
            ||:...||        .::|..|..:.|.||                |....||:          
plant     6 EGHMAMADRGSRKRRVGVKKGTKAARNKKQKSKPSTSDRFKVTMKNQKLFQKRARDYNSDDDEEE 70

  Fly    68 ----KSQAAVRFQK---DAANKKPGFDFEIEKADVKEEDEGDNHEDEKPQASALDATLTK----- 120
                |.|..|..::   ..||..|.:: ||.:.|..|..:|::|.:       :::.:||     
plant    71 DDESKKQPEVTIREKIFSDANMGPNYE-EIGEEDNDENSDGEDHGE-------IESGITKFATDG 127

  Fly   121 ---------------------------------------QQRKNVPLQLR-----------VKP- 134
                                                   :..|....|.|           ||| 
plant   128 CNAFKIAFKAIMKKTKGDDTLGPVLSAHKHLIGEKLAEDEAEKKAKGQARKAKHLIAEKGHVKPG 192

  Fly   135 SFRDMERERTLRKVATRGVVQFFNAVRIQQKDLQQQLEEAGPLDSRQDAVLNNINKRKFLDVLMS 199
            |:.| ..|:.|..|||:|||:.||||    ...|...:...|..|:...||....|..||..|  
plant   193 SYLD-SHEKILIGVATKGVVKLFNAV----NKAQHAQKGLNPSRSKDAKVLKKRRKEAFLSEL-- 250

  Fly   200 GKRAKST-PVDNAVKK-------------EEQETDDDDE----------DKGSSGKKKSE----- 235
            ||....| |.|....|             |:.....:.:          :|||....|||     
plant   251 GKTKTDTKPFDARRNKLVFCLDLAPIESHEKNHLMSESKLVFCLELASIEKGSPSAHKSEDEAPV 315

  Fly   236 WSVLREDFM-TNKKIKHWDEEDDDEEGHNDE----ADDSDYDD 273
            |:.||:::| .|.|:|.||::.:..||  |:    :.|..|:|
plant   316 WAPLRDNYMLANPKLKDWDKKQETSEG--DDFAGLSGDESYED 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3817NP_650405.2 Rrp15p <105..198 CDD:285173 30/148 (20%)
AT5G48240NP_001154769.1 Rrp15p 140..250 CDD:285173 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2974
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522334at2759
OrthoFinder 1 1.000 - - FOG0004819
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103633
Panther 1 1.100 - - LDO PTHR13245
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.