DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3817 and Rrp15

DIOPT Version :9

Sequence 1:NP_650405.2 Gene:CG3817 / 41805 FlyBaseID:FBgn0038275 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_080317.3 Gene:Rrp15 / 67223 MGIID:1914473 Length:281 Species:Mus musculus


Alignment Length:263 Identity:77/263 - (29%)
Similarity:128/263 - (48%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SDSSPEESDSEGSQNSASE---------AEGNAGWADSIQKVLKTTKPKTQKKTVLARAKKSQAA 72
            ||....|:|||.:..|..|         |..|:||||::.|:|....||: |.|:|.:.|     
Mouse    58 SDDGAAEADSEDNVESCEEDNEDAAESSAGTNSGWADAMAKILNKKTPKS-KATILTKNK----- 116

  Fly    73 VRFQKDAANKKPGFDFEIEKADVKEEDEGDNHEDEKPQASALDATLTKQQRKNVPLQLRVKPS-F 136
                            |:||            |.||.:...|:......:::...:..||||. .
Mouse   117 ----------------ELEK------------EKEKLKQERLEKRKQLDKKREWEMLCRVKPDVV 153

  Fly   137 RDMERERTLRKVATRGVVQFFNAVRIQQKDLQQQLEEAGPLDSRQDAVLNNINKRKFLDVL--MS 199
            :|.|.||.|:::|||||||.||||:..|:::.::::|||....::..:::.::|:.|:.||  |.
Mouse   154 KDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAGGSVRKRAKLMSTVSKKDFISVLRGMD 218

  Fly   200 GKRAKSTPVDNAVKKEEQETDDDDEDKGSSGKKKSEWSVLREDFMTNKKIKHWDEEDDDEEGHND 264
            | .::::|...:.|..:.|...::    |.|     |.:||:|||....:|.||:|.:.||....
Mouse   219 G-TSRNSPAGKSPKARQTEVKSEE----SPG-----WKILRDDFMMGASMKDWDKESEGEEPAGG 273

  Fly   265 EAD 267
            .|:
Mouse   274 RAE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3817NP_650405.2 Rrp15p <105..198 CDD:285173 32/95 (34%)
Rrp15NP_080317.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 21/57 (37%)
Rrp15p 101..215 CDD:285173 40/147 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..281 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844453
Domainoid 1 1.000 67 1.000 Domainoid score I9829
eggNOG 1 0.900 - - E1_KOG2974
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4936
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50095
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004819
OrthoInspector 1 1.000 - - oto93868
orthoMCL 1 0.900 - - OOG6_103633
Panther 1 1.100 - - LDO PTHR13245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2773
SonicParanoid 1 1.000 - - X5159
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.