DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3817 and RRP15

DIOPT Version :9

Sequence 1:NP_650405.2 Gene:CG3817 / 41805 FlyBaseID:FBgn0038275 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_011507899.1 Gene:RRP15 / 51018 HGNCID:24255 Length:368 Species:Homo sapiens


Alignment Length:214 Identity:63/214 - (29%)
Similarity:104/214 - (48%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SDSSPEESDSEG--------SQNSASEAEG-NAGWADSIQKVLKTTKPKTQKKTVLARAKKSQAA 72
            ||....|:||||        ::|....:.| |.||||::.|||....|:: |.|:|.:.||    
Human    58 SDDDAIEADSEGDAEPCDKENENDGESSVGTNMGWADAMAKVLNKKTPES-KPTILVKNKK---- 117

  Fly    73 VRFQKDAANKKPGFDFEIEKADVKEEDEGDNHEDEKPQASALDATLTKQQRKNVPLQLRVKPS-F 136
                             :||            |.||.:...|:....:.:|....:..||||. .
Human   118 -----------------LEK------------EKEKLKQERLEKIKQRDKRLEWEMMCRVKPDVV 153

  Fly   137 RDMERERTLRKVATRGVVQFFNAVRIQQKDLQQQLEEAGPLDSRQDAVLNNINKRKFLDVLMSGK 201
            :|.|.||.|:::|||||||.||||:..||::.::::|||....::..:::.::|:.|:.|| .|.
Human   154 QDKETERNLQRIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDFISVL-RGM 217

  Fly   202 RAKSTPVDNAVKKEEQETD 220
            ...:....::.||.:.:.|
Human   218 DGSTNETASSRKKPKAKQD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3817NP_650405.2 Rrp15p <105..198 CDD:285173 33/93 (35%)
RRP15XP_011507899.1 Rrp15p 102..215 CDD:285173 42/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154211
Domainoid 1 1.000 70 1.000 Domainoid score I9598
eggNOG 1 0.900 - - E1_KOG2974
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4914
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50095
OrthoDB 1 1.010 - - D1522334at2759
OrthoFinder 1 1.000 - - FOG0004819
OrthoInspector 1 1.000 - - oto90285
orthoMCL 1 0.900 - - OOG6_103633
Panther 1 1.100 - - LDO PTHR13245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2773
SonicParanoid 1 1.000 - - X5159
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.