DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3817 and SPAC227.02c

DIOPT Version :9

Sequence 1:NP_650405.2 Gene:CG3817 / 41805 FlyBaseID:FBgn0038275 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_592956.1 Gene:SPAC227.02c / 2541919 PomBaseID:SPAC227.02c Length:205 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:65/210 - (30%)
Similarity:91/210 - (43%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKTHAPASDSSPEE-----SDSEGSQNSASEAE-----GNAGWADSIQKVL--KTTKPKTQKKTV 62
            ||.....|::|.||     |:.|..|:::||.|     ..:..||.|..:|  :.|:...|...|
pombe    25 KKFVKDDSENSEEELEDLNSEDEFYQSNSSEDEIEEEVQESTIADDIADILNQQVTQTDEQDTPV 89

  Fly    63 LARAKKSQAAVRFQKDAANKKPGFDFEIEKADVKEEDEGDNHEDEKPQASALDATLTKQQRKNVP 127
            |:.:|||:.|:|  |..|.||                      |.|.:.|.....|.|:....|.
pombe    90 LSLSKKSKKALR--KSNAEKK----------------------DSKLRTSRRRERLRKEMVGRVT 130

  Fly   128 LQLRV-----KPSFRDMERERTLRKVATRGVVQFFNAVRIQQKDLQQQLEE---AGPLDSRQDAV 184
            ..:.|     |..|   ..||.||::|.|||||.|||||..|  ||..|..   :|...:|:..|
pombe   131 SVVAVNAETAKALF---THERELRRIARRGVVQLFNAVRTAQ--LQSSLNRENISGGRTAREQKV 190

  Fly   185 LNNINKRKFLDVLMS 199
             ..::|..|||::.|
pombe   191 -KELSKASFLDLIKS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3817NP_650405.2 Rrp15p <105..198 CDD:285173 35/100 (35%)
SPAC227.02cNP_592956.1 Rrp15p 82..203 CDD:285173 47/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I3609
eggNOG 1 0.900 - - E1_KOG2974
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2060
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004819
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103633
Panther 1 1.100 - - LDO PTHR13245
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5159
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.