DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14860 and thap1

DIOPT Version :9

Sequence 1:NP_650403.2 Gene:CG14860 / 41803 FlyBaseID:FBgn0038273 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001006738.1 Gene:thap1 / 448407 XenbaseID:XB-GENE-1008758 Length:225 Species:Xenopus tropicalis


Alignment Length:220 Identity:53/220 - (24%)
Similarity:84/220 - (38%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIVTDCYKSGQQDSS-SMYKFPI-NPVVRQKWLDNI--ADIKDINLFNSRVCRRHFETQCFGK-- 66
            |....|.....:|.. |.:|||: .|::.:||...:  ||.|....  |.:|..||...||.:  
 Frog     5 CSAYGCKNRYDKDKPISFHKFPLKRPLLCRKWEAAVRRADFKPTKY--SSICSDHFTADCFKREC 67

  Fly    67 -TKVF-SWAVPTLFLNTKEVVHQVSKPSRNSFIRRCSVRNCSSRSPPERLHFFPSNPEMRKA-WM 128
             .|:. ..||||:|.:|     ::.|.|..      :|:.....:.||.:   ||.||:..| .:
 Frog    68 NNKLLKDNAVPTIFAHT-----EIKKKSGK------AVKKEQLPAEPEPV---PSVPEVDPAIGL 118

  Fly   129 EICRLTVDNKWLFICGR--------HFRRTYLPNKGNLRKDAIPEFHLGTEEEDPLGKSIKSMKS 185
            .:..|...:....||..        |.||            .|.:..   |:.|.|.|.:|....
 Frog   119 LLPPLYTPSHIAVICDHNYTVEDTVHQRR------------RIQQLE---EQVDKLRKKLKIANQ 168

  Fly   186 CANRSNISFKSEDSGIDEESFKESK 210
            ...|...|.:..:..:.|  ::|:|
 Frog   169 KCRRQERSLEKLEREVSE--YREAK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14860NP_650403.2 DM3 24..80 CDD:128933 21/62 (34%)
DM3 114..169 CDD:128933 12/63 (19%)
thap1NP_001006738.1 THAP 5..81 CDD:368467 24/77 (31%)
Tropomyosin_1 <147..184 CDD:372267 9/51 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.