DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14860 and Thap12

DIOPT Version :9

Sequence 1:NP_650403.2 Gene:CG14860 / 41803 FlyBaseID:FBgn0038273 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001178559.1 Gene:Thap12 / 308845 RGDID:1309679 Length:757 Species:Rattus norvegicus


Alignment Length:310 Identity:73/310 - (23%)
Similarity:120/310 - (38%) Gaps:91/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIVTDCYKSGQQDSSSMYKFPINPVVRQKWLDNI--ADIKD-----INLFNSRVCRRHFETQCFG 65
            |...:|.:...|...:.::||.:|...|||::|.  ||::|     :|. :.|:|.:||||....
  Rat     5 CAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNK-HYRLCAKHFETSMIC 68

  Fly    66 KTKVFSW-----AVPTLF-----LNT---------KEVVHQVSKPSRNSFIRRCSVR----NCSS 107
            :|..:..     |:||:|     ||.         ||:.....:..:...|...|.:    |.::
  Rat    69 RTSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIEETSEQEQETNSNA 133

  Fly   108 RSPPERL------HFFP------SNPEMRKAWMEICRLTVDNKWLFICGRHFRRTYLPNKGNLRK 160
            ::|...:      :..|      .|.|..|:..||         |.:.|:.    .:|..|: ..
  Rat   134 QNPSAEVGNQQDGNVLPLTLEEKENKEYLKSLFEI---------LILMGKQ----NIPLDGH-EA 184

  Fly   161 DAIPEFHLGTEEEDPLGKSIKSMKSCANRSNISFKSEDSGIDEESFKESKPHNNPCAN---CLDL 222
            |.|||   |....|    :.:::..|  |.|       ||  ||..:  |.......|   |...
  Rat   185 DEIPE---GLFAPD----NFQALLEC--RIN-------SG--EEVLR--KRFETTAVNTLFCSKT 229

  Fly   223 QQ----QLAAAHLRIQQLEERRQEE-----TDSDDDEEGEEEEHIFMLMK 263
            ||    ::..:.:|.:.|.|.|...     ||...|..|  |||:.:|::
  Rat   230 QQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAG--EEHLPVLVR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14860NP_650403.2 DM3 24..80 CDD:128933 22/72 (31%)
DM3 114..169 CDD:128933 14/66 (21%)
Thap12NP_001178559.1 THAP 6..86 CDD:398893 23/80 (29%)
DUF4371 <153..326 CDD:405048 39/161 (24%)
Dimer_Tnp_hAT <668..725 CDD:399013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.