DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14860 and Thap7

DIOPT Version :9

Sequence 1:NP_650403.2 Gene:CG14860 / 41803 FlyBaseID:FBgn0038273 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_008767086.2 Gene:Thap7 / 287944 RGDID:1308061 Length:343 Species:Rattus norvegicus


Alignment Length:336 Identity:70/336 - (20%)
Similarity:106/336 - (31%) Gaps:121/336 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNLRCIVTDCYKS-GQQDSSSMYKFPI----NPVVRQKWLDNI--ADIKDINLFNSR-----VCR 56
            :.|.|....|.:: |:...|:..:..:    || .|..||.|.  .|.....|::..     .|.
  Rat    36 RGLTCAGAWCCRTLGRAGDSAFLRSKLPKKDNP-RRGLWLANCQRLDPSGQGLWDPTSEYIYFCS 99

  Fly    57 RHFETQCF------GKTKVFSWAVPTLF-------LNTKEVVH-------QVSKPSRNSFIRRCS 101
            :|||..||      |..::...||||:|       ...|..||       .||:      :|||.
  Rat   100 KHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTAKTKVHGYPPGLPDVSR------LRRCR 158

  Fly   102 VRNCSSRSPPERLHFFPSNPEMRKAWMEICRLTVDNKWLFICGRHFRRTYLPNKGNLRKDAIPEF 166
            .| ||.|..|.    .|.:|..|   .:|.|..|:..        .....||.....|.|.    
  Rat   159 KR-CSERQGPT----IPFSPPPR---ADIIRFPVEEA--------SAPATLPASPAARLDP---- 203

  Fly   167 HLGTEEEDPLGKSIKSMKSCANRSNISFKSEDSGIDEESFKESKP------HNNPCANCLDL--- 222
            .|.:...|.||.             :..:::::|...:...|..|      |.:|....|.|   
  Rat   204 GLNSPFSDLLGP-------------LGAQADEAGCSAQPSPEQHPSPLEPQHVSPSTYMLRLPPP 255

  Fly   223 ---------------------------------QQQLAAA-------HLRIQQLEERRQEETDSD 247
                                             |:||.|.       .||:.:|::.|..|..:.
  Rat   256 AGAYIQNEHSYQVGSALLWKRRAEAALDALDKTQRQLQACKRREQRLRLRLTKLQQERAREKRAQ 320

  Fly   248 DDEEGEEEEHI 258
            .|.....::|:
  Rat   321 ADARQTLKDHV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14860NP_650403.2 DM3 24..80 CDD:128933 20/79 (25%)
DM3 114..169 CDD:128933 10/54 (19%)
Thap7XP_008767086.2 THAP 4..127 CDD:214951 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.