DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14860 and AgaP_AGAP009530

DIOPT Version :9

Sequence 1:NP_650403.2 Gene:CG14860 / 41803 FlyBaseID:FBgn0038273 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_310159.2 Gene:AgaP_AGAP009530 / 1271378 VectorBaseID:AGAP009530 Length:193 Species:Anopheles gambiae


Alignment Length:101 Identity:23/101 - (22%)
Similarity:39/101 - (38%) Gaps:23/101 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIVTDC-YKSGQQDSSSMYKFPI-NPVVRQKWLDNIADIKDINLFNSR-----------VCRRHF 59
            |::.|| .|....|..|.:|||: :|.:.::|:.          |..|           :|.|||
Mosquito     5 CVIPDCDLKYTHSDDVSFHKFPLKSPELLKQWIQ----------FTGRDESWHPTKWSALCSRHF 59

  Fly    60 ETQCFGKTKVFSWAVPTLFLNTKEVVHQVSKPSRNS 95
            ....|.........:||...:.:..|...::|:..|
Mosquito    60 VASDFKGCAARKILLPTAVPSVRNAVAAKAQPNNLS 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14860NP_650403.2 DM3 24..80 CDD:128933 14/67 (21%)
DM3 114..169 CDD:128933
AgaP_AGAP009530XP_310159.2 THAP 4..82 CDD:214951 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.