DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14860 and LOC100498520

DIOPT Version :9

Sequence 1:NP_650403.2 Gene:CG14860 / 41803 FlyBaseID:FBgn0038273 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031750188.1 Gene:LOC100498520 / 100498520 -ID:- Length:706 Species:Xenopus tropicalis


Alignment Length:291 Identity:66/291 - (22%)
Similarity:107/291 - (36%) Gaps:86/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RCIVTDCYKSGQQDSS-SMYKFPINPVVRQKWLDNIA-DIKDINLFNSRV-----------CRRH 58
            :|||.:|..:.|::|. :::.||.:....:.||.... |..|::.|..||           |.:|
 Frog     3 KCIVKECKNTTQKNSGVTLHGFPNSLNAIKVWLIQTGNDFGDLDAFAQRVLESRSRWLYRMCSKH 67

  Fly    59 FETQCF---GKTKVFS-WAVPTLFLNTKEVVHQVSKPSRNSFIRRCSVRNCSSRSPPERLHFFPS 119
            |..|.:   ||..|.. .||||:|            |.:        |:|   |...|.|...|.
 Frog    68 FSPQSYIWSGKKLVLKPDAVPTIF------------PGK--------VKN---RYVTENLRGLPP 109

  Fly   120 NPEMRKAWMEICRLTVDNKWLFICGRHFRRTYLPNKGNLRKDAIPEFHLGTEEED--PLGK---- 178
            :   ::|.:|: :..:.:......|.|....|:|...:      |. |:..|:..  |..|    
 Frog   110 S---KRAQVEM-QFQLHSIIKQHGGYHPTSLYVPPSSD------PP-HVTREQAQYKPGAKTTST 163

  Fly   179 -SIKSMKSCANRSNISFKSEDSGI---------DEESFKESKPHNNPCANCLDLQQQL--AAAHL 231
             :.|.|...:..::..|...|.|:         |.|::|....|..| .|...|:..:  |||  
 Frog   164 ATTKVMVDKSTNTDPMFGKADKGVLWPEFEYNFDGEAWKIKHDHFYP-YNRSSLRDSIKNAAA-- 225

  Fly   232 RIQQLEERRQEETDSD-----DDEEGEEEEH 257
                     :.||:.|     |.|..:...|
 Frog   226 ---------EAETEQDFWYTNDYETDKNSRH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14860NP_650403.2 DM3 24..80 CDD:128933 21/71 (30%)
DM3 114..169 CDD:128933 10/54 (19%)
LOC100498520XP_031750188.1 THAP 5..91 CDD:398893 25/85 (29%)
KRAB_A-box 274..310 CDD:143639
C2H2 Zn finger 566..586 CDD:275368
zf-C2H2 592..613 CDD:395048
C2H2 Zn finger 593..613 CDD:275368
zf-C2H2 619..641 CDD:395048
C2H2 Zn finger 621..641 CDD:275368
C2H2 Zn finger 649..669 CDD:275368
C2H2 Zn finger 677..697 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.