powered by:
Protein Alignment CG14860 and c14orf28
DIOPT Version :9
Sequence 1: | NP_650403.2 |
Gene: | CG14860 / 41803 |
FlyBaseID: | FBgn0038273 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002940585.1 |
Gene: | c14orf28 / 100494240 |
XenbaseID: | XB-GENE-6041562 |
Length: | 310 |
Species: | Xenopus tropicalis |
Alignment Length: | 140 |
Identity: | 33/140 - (23%) |
Similarity: | 44/140 - (31%) |
Gaps: | 43/140 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 QNLRCIVTDCYKSGQQDSSSMYKFPINPVVRQKWLDNIADIKDINLFNSRVCRRHFETQCFGKTK 68
|...|..|||....|: :.|:...|||. .||.:.:|...
Frog 151 QESYCSNTDCPTRVQE--TQMHTILINPP---------HDIPNGDLIQI---------------- 188
Fly 69 VFSWAVPTLFLNTKEVVHQVSKPSRNSFIRRCSVRNCSSRSPPERLHFFPSNPEMRK----AWME 129
||..||.:..|...:.. ...:|..|.||.....|| |...|.|..| |::.
Frog 189 ----AVDELFCSKTEPCEEYG----CGCLREFSPRNFCHGPPP----FVILNMEQWKSEELAYVP 241
Fly 130 ICRLTVDNKW 139
.|....|||:
Frog 242 YCLELSDNKY 251
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14860 | NP_650403.2 |
DM3 |
24..80 |
CDD:128933 |
11/55 (20%) |
DM3 |
114..169 |
CDD:128933 |
9/30 (30%) |
c14orf28 | XP_002940585.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.