DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14860 and rpusd1

DIOPT Version :9

Sequence 1:NP_650403.2 Gene:CG14860 / 41803 FlyBaseID:FBgn0038273 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031748736.1 Gene:rpusd1 / 100380010 XenbaseID:XB-GENE-953402 Length:750 Species:Xenopus tropicalis


Alignment Length:247 Identity:56/247 - (22%)
Similarity:88/247 - (35%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIVTDCYKS----GQQDSSSMYKFPINPVVRQKWLDN--------------IADIKDINLFNSRV 54
            |:|..|..|    |......::.||.|....::||.|              :.|.|..|.:  |:
 Frog    36 CLVHGCRHSTARKGLYPGIVLHGFPKNLSRIKQWLLNTGQNFGNLDAFAQKVLDGKKHNSY--RI 98

  Fly    55 CRRHFETQCF---GKTK---------VFSWAVPTLFLNTKEVVHQVSKPSRNSFIRRCSVR---N 104
            |..||.:.|:   |.||         :|:|..|....::...:|:.:.|.|.  ..||..:   :
 Frog    99 CSSHFSSDCYVQLGCTKGLKADAVPTIFAWNTPGESEDSAYHIHRSTYPERP--CGRCMKKKMVD 161

  Fly   105 CSSRSPPERLHFFPSNPEMRKAWMEICRLTVDNKWLFICGRHFRRTYL---------PNKGNLR- 159
            .|:.:.|...     :.|....|.|....|...:|..   :|....||         |..|..| 
 Frog   162 ASTLTDPAMF-----SKEAGVQWPEFEFNTAGERWKI---KHDHYYYLSSSRKSTQKPTVGRDRQ 218

  Fly   160 KDAIPEFHLGTEEEDPLGKSIKSMKSCANRSNISFKSEDSGIDEESFKESKP 211
            ||...:.:...:|||       ..:...|.||.||::..|.:..:.|....|
 Frog   219 KDTSNKINNKDDEED-------DDEDDDNDSNDSFQTHQSSVHVDPFYSGIP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14860NP_650403.2 DM3 24..80 CDD:128933 20/81 (25%)
DM3 114..169 CDD:128933 13/64 (20%)
rpusd1XP_031748736.1 THAP 38..126 CDD:398893 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.