DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14860 and si:ch73-382f3.1

DIOPT Version :9

Sequence 1:NP_650403.2 Gene:CG14860 / 41803 FlyBaseID:FBgn0038273 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001243612.1 Gene:si:ch73-382f3.1 / 100151273 ZFINID:ZDB-GENE-030131-9513 Length:283 Species:Danio rerio


Alignment Length:271 Identity:55/271 - (20%)
Similarity:86/271 - (31%) Gaps:117/271 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CIVTDCYKS---GQQDSSSMYKFPINPVVRQKWLDNIADIKD-INLFNSRVCRRHFETQCF---- 64
            |...:|..|   |:|    :::||.:||..:|||.|..  :| :....||:|:.|||...|    
Zfish     4 CSAPNCSNSTTIGKQ----LFRFPKDPVRMRKWLVNCR--RDFVPTPCSRLCQDHFEESQFEEIA 62

  Fly    65 ----GKTKVFSWAVPTLFLNTKEVVHQVSKPSRNSFIRRCSVRNCSSRSPPERLHFFPSNPEMRK 125
                |..|:...|:|||| |..:                          ||.     |..|:   
Zfish    63 RSPAGGRKLKPNAIPTLF-NVPD--------------------------PPS-----PVTPQ--- 92

  Fly   126 AWMEICRLTVDNKWLFICGRHFRRTYLPNKGNLRKDAIPEFHLGTEEEDPLGKSIKSMKSCANRS 190
                                    ..||.|                 .:|:.|.:........|.
Zfish    93 ------------------------AVLPVK-----------------NEPVEKELNMGDHGYARR 116

  Fly   191 NISFKSEDSGI---DEESFKESKPHNNPCANCLDLQQQLAAAHLRIQQLEERRQEETDSDDDEEG 252
            .....||:.|:   :||         .||:.|...:.:|           |::|:.|.....|..
Zfish   117 QPPVDSEEDGVQRAEEE---------RPCSLCQHYKTKL-----------EQQQQHTVRLQREAE 161

  Fly   253 EEEEHIFMLMK 263
            |.::.::.|.|
Zfish   162 EMKKRLYKLSK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14860NP_650403.2 DM3 24..80 CDD:128933 23/64 (36%)
DM3 114..169 CDD:128933 5/54 (9%)
si:ch73-382f3.1NP_001243612.1 THAP 4..81 CDD:283206 28/83 (34%)
Tnp_P_element 146..>259 CDD:288840 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.