DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CCNQ

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_689487.2 Gene:CCNQ / 92002 HGNCID:28434 Length:248 Species:Homo sapiens


Alignment Length:226 Identity:58/226 - (25%)
Similarity:96/226 - (42%) Gaps:30/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KVFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGV- 102
            :|....|..|...|.:|.:|...||||...:.:|:...:|...||.|:|.:.|.||.||||..: 
Human    25 RVHFRVARFIMEAGVKLGMRSIPIATACTIYHKFFCETNLDAYDPYLIAMSSIYLAGKVEEQHLR 89

  Fly   103 ------ISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQ 161
                  :|| |..:.....::..      ..|....:.|::||..:|..|...:....|::.||.
Human    90 TRDIINVSN-RYFNPSGEPLELD------SRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLH 147

  Fly   162 --------LVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIAC------VILQKD 212
                    |.:...|...:...:|.::.||....:||.:....||:|.|.:|.      |..:.:
Human   148 YLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQAQHIAVAVLYLALQVYGVEVPAEVE 212

  Fly   213 ATKQWFAELNVDLDK--VQEIVRAIVNLYEL 241
            |.|.|:...|.||.|  :..||..::.:|.:
Human   213 AEKPWWQVFNDDLTKPIIDNIVSDLIQIYTM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 31/112 (28%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 26/104 (25%)
CCNQNP_689487.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
CYCLIN_CCNM_CCNQ_rpt1 26..135 CDD:410237 32/115 (28%)
CYCLIN_CCNM_CCNQ_rpt2 140..243 CDD:410238 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.