DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CCNT2

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_490595.1 Gene:CCNT2 / 905 HGNCID:1600 Length:730 Species:Homo sapiens


Alignment Length:244 Identity:61/244 - (25%)
Similarity:110/244 - (45%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFG-----VIS 104
            ||:||.:|::|.:.|..|.||.||..|||..:|....:..:::.|.:.||:||||..     || 
Human    41 ANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI- 104

  Fly   105 NSRLISIC----QSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQD 165
              ::...|    :..:.||.. ||.|:    |..::..|..:|:.|...:.:..|:..:::..|.
Human   105 --KVAHACLHPLEPLLDTKCD-AYLQQ----TQELVILETIMLQTLGFEITIEHPHTDVVKCTQL 162

  Fly   166 MGQEDQLLTLSWRIVNDSLR-TDVCLLYPPYQIAIACLQIAC------VILQKDATKQW-FAELN 222
            :.....|...|:.:..:||. |..||.|.|..||..|:.:||      :.:..|....| :.:..
Human   163 VRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPT 227

  Fly   223 VDLDKVQEIVRAIVNLYELW-------KDWK-----EKDEIQMLLSKIP 259
            |.|:.:.|:....:.:.|..       ::|:     .|.::...:|:.|
Human   228 VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 34/109 (31%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 22/105 (21%)
CCNT2NP_490595.1 Interaction with MDFIC and MDFI. /evidence=ECO:0000269|PubMed:17289077 1..300 61/244 (25%)
CCL1 8..>216 CDD:227640 51/182 (28%)
CYCLIN 37..108 CDD:238003 25/69 (36%)
Interaction with POLR2A. /evidence=ECO:0000269|PubMed:15563843 250..300 4/27 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..430
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.