DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CCNT1

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001231.2 Gene:CCNT1 / 904 HGNCID:1599 Length:726 Species:Homo sapiens


Alignment Length:289 Identity:67/289 - (23%)
Similarity:116/289 - (40%) Gaps:58/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QSSHSQQWILDKPDLLRERQHDLLALNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKR 71
            ::|.|:::.:|....|..||.                .||::|.:|::|.:.|..|.||.||..|
Human    20 ENSPSRRFGVDPDKELSYRQQ----------------AANLLQDMGQRLNVSQLTINTAIVYMHR 68

  Fly    72 FYARNSLKNIDPLLLAPTCILLASKVEE-----FGVISNSRLISICQSAIKTKFSYAYAQEFPYR 131
            ||...|........:||..:.||:||||     ..||..:......|.::....|.||.|:    
Human    69 FYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQ---- 129

  Fly   132 TNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLR-TDVCLLYPPY 195
            ...::..|..:|:.|...|.:..|:..:::..|.:.....|...|:.:..:||. |...|.|.|.
Human   130 VQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPP 194

  Fly   196 QIAIACLQIAC------VILQKDATKQW-FAELNVDLDKVQEIVRAIVNLYE--------LWKDW 245
            .:|..|:.:||      :.:..|....| :.:..|.|:.:.|:....:.:.|        :| :|
Human   195 VVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIW-NW 258

  Fly   246 K----------------EKDEIQMLLSKI 258
            :                ||...|.:|:.|
Human   259 RACEAAKKTKADDRGTDEKTSEQTILNMI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 32/110 (29%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 21/106 (20%)
CCNT1NP_001231.2 Cyclin_N 13..149 CDD:278560 39/148 (26%)
Nuclear localization signal, and interaction with Tat-TAR RNA. /evidence=ECO:0000255 253..270 2/17 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 487..650
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.