DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CCNH

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005248684.1 Gene:CCNH / 902 HGNCID:1594 Length:329 Species:Homo sapiens


Alignment Length:236 Identity:64/236 - (27%)
Similarity:114/236 - (48%) Gaps:28/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFG 101
            |:|..:.|.:|.:.     .:.:.|:.||.:||||||..||:....|.::..||..||.||:||.
Human    60 YEKRLLEFCSVFKP-----AMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFN 119

  Fly   102 VISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDM 166
            |.|...:.::.:|.:        .||  .....|||.|..|::.|:..|||:.||||....:.|:
Human   120 VSSPQFVGNLRESPL--------GQE--KALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDL 174

  Fly   167 GQEDQLL---TLSWRIVNDSLR----TDVCLLYPPYQIAIACL----QIACVILQKDATKQWFAE 220
            .....:|   .:..:..:|.|.    ||..|||.|.|||:..:    ..|.:.::...::....:
Human   175 KTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLK 239

  Fly   221 LN-VDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPK 260
            .| ..|.::.:|::::.||.:.::. ...:|:.:|..|:.:
Human   240 ENRTCLSQLLDIMKSMRNLVKKYEP-PRSEEVAVLKQKLER 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 32/105 (30%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 23/102 (23%)
CCNHXP_005248684.1 ccl1 2..308 CDD:129660 64/236 (27%)
CYCLIN 62..152 CDD:214641 33/104 (32%)
Cyclin_C_2 162..262 CDD:293504 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.