DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CCNC

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_005181.2 Gene:CCNC / 892 HGNCID:1581 Length:283 Species:Homo sapiens


Alignment Length:265 Identity:192/265 - (72%)
Similarity:228/265 - (86%) Gaps:1/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGNFWQSSHSQQWILDKPDLLRERQHDLLALNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATA 65
            ||||||||||..||||||.|||:|||.||..|:|:||.|:.|||.||||.|||.|||||||||||
Human     1 MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATA 65

  Fly    66 TVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYAQEFPY 130
            ||||||||||.|||:|||:|:||||:.||||||||||:||:|||:...|.:||:||||:.:||||
Human    66 TVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPY 130

  Fly   131 RTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPY 195
            |.||||||||||||.:|||||||.|||||||.||||||||.||.|:||||||:.|||:||||||:
Human   131 RMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPF 195

  Fly   196 QIAIACLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPK 260
            .||:|||.:|||:.|||| :||||||:||::|:.||:|.|:.|||.||::.|:.|:..:|||:||
Human   196 MIALACLHVACVVQQKDA-RQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPK 259

  Fly   261 PKPPP 265
            |||||
Human   260 PKPPP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 81/105 (77%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 63/90 (70%)
CCNCNP_005181.2 CYCLIN_CCNC_rpt1 40..146 CDD:410217 81/105 (77%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 63/91 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..283 10/13 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3577
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3803
Inparanoid 1 1.050 407 1.000 Inparanoid score I1896
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55499
OrthoDB 1 1.010 - - D1079428at2759
OrthoFinder 1 1.000 - - FOG0003755
OrthoInspector 1 1.000 - - oto91567
orthoMCL 1 0.900 - - OOG6_103590
Panther 1 1.100 - - LDO PTHR10026
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1389
SonicParanoid 1 1.000 - - X2616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.