DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CCL1

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_015350.1 Gene:CCL1 / 856136 SGDID:S000006229 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:240 Identity:65/240 - (27%)
Similarity:103/240 - (42%) Gaps:61/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSHSQQWILDKPDLLRERQ---------------------HDL------------LALNEDEYQK 39
            ||..:.|...| |.|:|::                     |:|            :.|..:|...
Yeast    52 SSQYRMWSYTK-DQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKVLEAKAIPLTMEEELD 115

  Fly    40 VFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVIS 104
            :..|:|..:||:.:.|.|..:|:|||..:|:||:..||:..|||..:..|.|.||.|.|.:.:..
Yeast   116 LVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISV 180

  Fly   105 NSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPL------LQLV 163
            :|                 :||:.....:.:|:.||.|||:|...|:.:.||:||      :|.|
Yeast   181 DS-----------------FAQKAKSTRDSVLKFEFKLLESLKFSLLNHHPYKPLHGFFLDIQNV 228

  Fly   164 ----QDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQI 204
                .|:....|:.....:.:..:|.|||...|.|.||.:|.|.|
Yeast   229 LYGKVDLNYMGQIYDRCKKRITAALLTDVVYFYTPPQITLATLLI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 33/105 (31%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 19/61 (31%)
CCL1NP_015350.1 ccl1 49..376 CDD:129660 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.