DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CCNL2

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011540518.1 Gene:CCNL2 / 81669 HGNCID:20570 Length:553 Species:Homo sapiens


Alignment Length:280 Identity:64/280 - (22%)
Similarity:115/280 - (41%) Gaps:62/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKR-FYARNSLK-NIDP-LLLAPT---- 89
            |:.|....:.:....:||..|..|:|.|..:||..|.|:| ||.::.:| :::| .|..|:    
Human    69 LDTDTETDLRVVGCELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEPSSLWRPSGRRG 133

  Fly    90 --------------------------------------CILLASKVEEFGVISNSRLISICQSAI 116
                                                  |:...|..|        |..::|..:.
Human   134 WGQTWACCNASASACVNGLCPPGFQDRRGPKTHTGRHQCVSPPSTAE--------RQKTLCSLSG 190

  Fly   117 KTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQ--DMGQEDQLLTLSWRI 179
            :........|::....|.|::.|..:|:.|..|:.|..|::.::..:|  :..:...|:..||..
Human   191 RKPVPLLLDQDYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQHLVQTSWNY 255

  Fly   180 VNDSLRTDVCLLYPPYQIAIACLQIACVILQKDATKQ--WFAELNVDLDKVQEIVRAIVNLYELW 242
            :||||||||.:.:.|..||.||:.:|...|:.....:  ||.......:::|||...|:.||.  
Human   256 MNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICLKILQLYA-- 318

  Fly   243 KDWKEKDEIQMLLSKIPKPK 262
               ::|.::..|..::.|.|
Human   319 ---RKKVDLTHLEGEVEKRK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 27/150 (18%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 28/94 (30%)
CCNL2XP_011540518.1 CCL1 69..>306 CDD:227640 54/244 (22%)
CYCLIN 233..315 CDD:214641 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.