DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and Ccnh

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_075732.1 Gene:Ccnh / 66671 MGIID:1913921 Length:323 Species:Mus musculus


Alignment Length:249 Identity:69/249 - (27%)
Similarity:120/249 - (48%) Gaps:35/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HDLLALNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCI 91
            |:.|.|.: .|:|..:.|.:|.:.     .:.:.|:.||.:||||||..||:....|.::..||.
Mouse    51 HEELTLCK-YYEKRLLEFCSVFKP-----AMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCA 109

  Fly    92 LLASKVEEFGVISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPY 156
            .||.||:||.|.|...:.::.:|.:        .||  .....|||.|..|::.|:..|||:.||
Mouse   110 FLACKVDEFNVSSPQFVGNLRESPL--------GQE--RALEQILEYELLLIQQLNFHLIVHNPY 164

  Fly   157 RPLLQLVQD------MGQEDQLLTLSWRIVNDSLR----TDVCLLYPPYQIAIACL----QIACV 207
            ||....:.|      |.:..::|.   :..:|.|.    ||..|||.|.|||:..:    ..|.:
Mouse   165 RPFEGFLIDIKTRYPMLENPEILR---KTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGI 226

  Fly   208 ILQKDATKQWFAELN-VDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPK 260
            .::...::....:.| ..|.::.:|::::.||.:.::. ...||:.:|..|:.:
Mouse   227 TMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEP-PRSDEVAVLKQKLER 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 32/105 (30%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 24/105 (23%)
CcnhNP_075732.1 ccl1 2..308 CDD:129660 69/249 (28%)
CYCLIN 62..152 CDD:214641 33/104 (32%)
Cyclin_C_2 162..262 CDD:293504 24/102 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.