DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and CycK

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286131.1 Gene:CycK / 49816 FlyBaseID:FBgn0025674 Length:400 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:122/281 - (43%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WILDKPDLLRERQHDLLALN---EDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYAR 75
            |..||.: |||....|..::   |..|:|.   .|..|...|.::.|....:||..|||.|||..
  Fly     4 WYYDKKE-LRETPSILDGISFETERRYRKE---GARFIMECGTKMGLGHNTMATGVVYFHRFYMF 64

  Fly    76 NSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKT-------KFSYAYAQEFPYRTN 133
            :|.::....:.|..|:..|.||||        ....|:..|||       .:.|::..:   ...
  Fly    65 HSFRSFPRYVTACCCLFFAGKVEE--------TPKKCRDIIKTARGILTDNYFYSFGDD---PKE 118

  Fly   134 HILECEFYLLENLDCCLIVYQPYRPLLQLVQ----DMGQEDQLLTLSWRIVNDSLRTDVCLLYPP 194
            .::..|..||:.:...|.|..||..||:..:    |..:..:::.::|..|||||.|.|||.:.|
  Fly   119 EVMTLERILLQTIKFDLQVEHPYTFLLKYAKCFKGDQQKLQKMVQMAWNFVNDSLSTVVCLQWEP 183

  Fly   195 YQIAIACLQIACVILQKDATKQW-------------FAELNVDLDKVQEIVRAIVNLYELWKDWK 246
            ..||:|.:.:|.. |.|...:.|             |.. :|.::.:::|...:::||:.    .
  Fly   184 EIIAVALIHLASK-LSKFTVQDWEGRQPQQQRWWDMFVS-DVTMEILEDICHQVLDLYQS----T 242

  Fly   247 EKDEIQMLLSKIPKPKPPPQR 267
            :|:.:|        |..|||:
  Fly   243 QKEALQ--------PTSPPQK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 28/112 (25%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 28/107 (26%)
CycKNP_001286131.1 CYCLIN 30..128 CDD:238003 27/111 (24%)
CYCLIN 139..>197 CDD:238003 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.