DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and ccnl1b

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_956034.1 Gene:ccnl1b / 326088 ZFINID:ZDB-GENE-030131-4813 Length:498 Species:Danio rerio


Alignment Length:235 Identity:61/235 - (25%)
Similarity:104/235 - (44%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEF------------ 100
            ||..|..|:|.|..:||..|.|:||:...|....:..::|..|:.||||:||.            
Zfish    70 IQSAGILLRLPQVAMATGQVIFQRFFFSKSFVKHNFEIVAMACVNLASKIEESPRRVRDVINVFH 134

  Fly   101 ----GVISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQ 161
                |....|..:.:.|:.|.||             |.:::.|..:|:.|..|:.|..|::.::.
Zfish   135 HLKQGKGKKSTPLILDQNYINTK-------------NQVIKAERRILK
ELGFCVHVKHPHKIIVM 186

  Fly   162 LVQ--DMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQ--KDATKQWFAELN 222
            .:|  :..:...|:..:|..:||:|||...:.:.|..||.||:.:|..:||  ..:...||....
Zfish   187 YLQVLECEKNQMLVQTAWNYMNDALRTSAFVRFEPETIACACIYLAARVLQIPLPSKPHWFLLFG 251

  Fly   223 VDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPKPK 262
            ...:.::||....:.||.     :||...:.|..::.|.|
Zfish   252 ATKEDIKEICINTMKLYS-----REKPHSEQLERQVEKRK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 30/113 (27%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 23/94 (24%)
ccnl1bNP_956034.1 CYCLIN 62..134 CDD:238003 21/63 (33%)
Cyclin-like 1 68..169 29/111 (26%)
Cyclin-like 2 182..266 20/83 (24%)
CYCLIN 184..260 CDD:214641 18/75 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..498
RS 366..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.