DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and ccnt2b

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_997751.1 Gene:ccnt2b / 321464 ZFINID:ZDB-GENE-030131-183 Length:569 Species:Danio rerio


Alignment Length:214 Identity:53/214 - (24%)
Similarity:95/214 - (44%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSR-- 107
            ||:||.:|::|.:.|..|.||.||..|||..||.......:::||.:.||:||||     ..|  
Zfish    42 ANLIQDMGQRLNVSQLTINTAIVYMHRFYMLNSFTKFHRNIISPTTLFLAAKVEE-----QPRKL 101

  Fly   108 --LISICQSAIK------TKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQ 164
              :|.:..:.:.      ...|.||.|:    ...::..|..:|:.|...:.:..|:..:::..|
Zfish   102 EHVIKVAHACLNPHDPPLDSKSSAYLQQ----AQELVLLETIVLQTLGFEIT
IEHPHTDVVRCTQ 162

  Fly   165 DMGQEDQLLTLSWRIVNDSLR-TDVCLLYPPYQIAIACLQIAC------VILQKDATKQW-FAEL 221
            .:.....|...|:.:..:||. |..||.:.|..:|..|:.:||      :.:..|....| :.:.
Zfish   163 LVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVVACVCIHLACKWSNWEIPVSSDGKHWWEYVDR 227

  Fly   222 NVDLDKVQEIVRAIVNLYE 240
            .|.|..:.::....:.:.|
Zfish   228 AVTLQLLDDLTHEFLQILE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 33/110 (30%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 19/95 (20%)
ccnt2bNP_997751.1 Cyclin_N 13..149 CDD:278560 34/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.