DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and Ccnq

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001020583.1 Gene:Ccnq / 303321 RGDID:1305651 Length:250 Species:Rattus norvegicus


Alignment Length:224 Identity:50/224 - (22%)
Similarity:91/224 - (40%) Gaps:44/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISIC 112
            |...|.:|.::...||||...:.:|:...:|...|..|:|.:.:.||.||||             
  Rat    36 IMEAGVKLGMQSIPIATACTIYHKFFCEINLDAYDLYLVAMSSLYLAGKVEE------------- 87

  Fly   113 QSAIKTK----FSYAY----------AQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLV 163
             ..::|:    .|:.|          ...|....:.|::||..:|..|...:....|::.||..:
  Rat    88 -QHLRTRDIINVSHRYFNPGSEPLELDSRFWELRDSIVQCELLMLRVLRFQ
VSFQHPHKYLLHYL 151

  Fly   164 QDM--------GQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIAC------VILQKDAT 214
            ..:        .|...:...:|.::.||....:||.:....:|:|.|.:|.      |..:.:|.
  Rat   152 ISLKNWLNRYSWQRTPISVTAWALLRDSYHGGLCLRFQAQHLAVAVLYLALQVYGVEVPAEGEAE 216

  Fly   215 KQWFAELNVDLDK--VQEIVRAIVNLYEL 241
            |.|:...:.||.|  :..||..::.:|.:
  Rat   217 KPWWQVFSDDLTKPIIDNIVSDLIQIYTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 26/111 (23%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 23/104 (22%)
CcnqNP_001020583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CYCLIN_CCNM_CCNQ_rpt1 29..137 CDD:410237 27/114 (24%)
CYCLIN_CCNM_CCNQ_rpt2 142..245 CDD:410238 23/102 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.