DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and Ccnl2

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006239606.1 Gene:Ccnl2 / 298686 RGDID:1309149 Length:521 Species:Rattus norvegicus


Alignment Length:231 Identity:66/231 - (28%)
Similarity:115/231 - (49%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VIQVLGEQLKLRQQVIATATVYFKRF-----YARNSLKNIDPLLLAPTCILLASKVEEF-----G 101
            :||..|..|:|.|..:||..|.|:||     :.::|::::     :..|:.||||:||.     .
  Rat    82 LIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHV-----SMACVHLASKIEEAPRRIRD 141

  Fly   102 VIS-NSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQ- 164
            ||: ..||..:.:.  |........||:....|.|::.|..:|:.|..|:.|..|::.::..:| 
  Rat   142 VINVFHRLRHLREK--KKPVPLVLDQEYVNLKNQIIKAERRVLKELGFC
VHVKHPHKIIVMYLQV 204

  Fly   165 -DMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQKDATKQ--WFAELNVDLD 226
             :..:...|:..:|..:||||||||.:.:.|..||.||:.:|...|:.....:  ||.......:
  Rat   205 LECERNQHLVQTAWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEE 269

  Fly   227 KVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPKPK 262
            ::|||...|:.||.     ::|.::..|.|::.|.|
  Rat   270 EIQEICFKILQLYT-----RKKVDLTHLESEVEKRK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 31/109 (28%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 27/94 (29%)
Ccnl2XP_006239606.1 CYCLIN_CCNL2_rpt1 33..188 CDD:410293 32/112 (29%)
CYCLIN_CCNL2_rpt2 193..315 CDD:410296 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.