DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and cyh-1

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001379352.1 Gene:cyh-1 / 190078 WormBaseID:WBGene00021714 Length:337 Species:Caenorhabditis elegans


Alignment Length:213 Identity:60/213 - (28%)
Similarity:96/213 - (45%) Gaps:45/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TATVYFKRFY-----ARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYA 123
            ||..:|||.:     :..|::     ::...|..||.|::||       .|:| :..:|...||:
 Worm    80 TALAFFKRAFLVWVPSDTSIR-----MVMMACFYLAMKIDEF-------YITI-EDFVKNMKSYS 131

  Fly   124 YAQEFPYRTN--HILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTL--------SWR 178
            ..:.   |.|  .||:.|..|::.||..|.|:.||||....:.||.....||..        |.|
 Worm   132 VGEP---RQNAERILKLEPELMKILDYNL
TVHCPYRPYEGHLMDMKTRMLLLNFDLESIRRDSMR 193

  Fly   179 IVNDSLRTDVCLLYPPYQIAIACLQIACVILQKDATKQWFAELNVDLDKV-QEIVRAIVNLYELW 242
            ...::|:|||.|||||.|||:|.:....           .|:::...|:: :|.:|.::.:.|  
 Worm   194 FFQNALQTDVLLLYPPSQIALAAINFGL-----------HAQVSGKSDEILREFLRKLIGIEE-- 245

  Fly   243 KDWKEKDEIQMLLSKIPK 260
            ..|..:|.....|.|:.|
 Worm   246 DSWAHRDARPEDLEKLEK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 23/88 (26%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 28/99 (28%)
cyh-1NP_001379352.1 CYCLIN_CCNH_rpt1 3..157 CDD:410228 25/92 (27%)
CYCLIN_CCNH_rpt2 160..310 CDD:410229 33/117 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.