DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and ccnk-1

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_506615.2 Gene:ccnk-1 / 185704 WormBaseID:WBGene00009650 Length:252 Species:Caenorhabditis elegans


Alignment Length:215 Identity:59/215 - (27%)
Similarity:101/215 - (46%) Gaps:29/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EQLKLRQQV-----------IATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNS 106
            |.:||..:|           |..|.|||.|||..:|.::....:.|.:|:.||.|||:|    ..
 Worm    32 EGIKLLSEVGNALNCKPRPTIGVAAVYFHRFYMIHSFQSFSREVTALSCLFLAGKVEDF----PK 92

  Fly   107 RLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLL---QLVQDMGQ 168
            :...:||:|: |.:...|: ::....:.::..|..||.:|...|.|..||..||   .:..||.:
 Worm    93 KCKDVCQAAV-THYPEIYS-KYQNLVDDVMGLERVLLHSLKFDLHVALPYDALLDYKMMFPDMNR 155

  Fly   169 E--DQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVI-----LQKDATKQWFAE--LNVD 224
            |  ...:.::|..:|||:.|.:|:...|..||||.|.:|..:     :||:....|::.  .|..
 Worm   156 EKITDAVQIAWTFINDSIYTTLCITTEPQMIAIALLHLAFTVKGYQPVQKNMDPCWWSADVSNWP 220

  Fly   225 LDKVQEIVRAIVNLYELWKD 244
            .:.|.:....:::.|...|:
 Worm   221 QESVDKACHLVLDFYAATKE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 29/103 (28%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 27/103 (26%)
ccnk-1NP_506615.2 CCL1 12..250 CDD:227640 59/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.