DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and cit-1.1

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001370392.1 Gene:cit-1.1 / 176125 WormBaseID:WBGene00000507 Length:468 Species:Caenorhabditis elegans


Alignment Length:273 Identity:43/273 - (15%)
Similarity:98/273 - (35%) Gaps:87/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QWILDKPDLLR--------ERQHDLLALNEDEYQKVFIFFANVIQVLGE----QLKLRQQVIATA 65
            :|:..|.::.:        .|:.:|.:     .|....|...:|..|..    ::|:....:..|
 Worm    19 KWLFTKEEMKKTASIQEGMSREEELAS-----RQMAAAFIQEMIDGLNNVKDPKMKIGHTGLCVA 78

  Fly    66 TVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYAQEFPY 130
            ..:..|||..:|.|..|...:...|:.||.|                            :||.|.
 Worm    79 HTHMHRFYYLHSFKKYDYRDVGAACVFLAGK----------------------------SQECPR 115

  Fly   131 RTNHILE--------------------------CEFYLLENLDCCLIVYQPYRPLLQLVQDMGQE 169
            :.:|::.                          .|..:|:.:...|.|:.|:..:|.:::.:.::
 Worm   116 KLSHVISVWRERKDRKQLTTETARNEAAQIIVLLESMILQTIAFDLNVHLPHIYVLDIMKKVDKK 180

  Fly   170 DQ---LLTLSWRIVNDSLR-TDVCLLYPPYQIAIACLQI----ACVILQK------DATKQWFAE 220
            :.   |.:.::....|.:. ||..|.|....::|..:.:    |.|.:::      :....|:|:
 Worm   181 EHYRPLTSCAYYFATDVIAVTDWSLRYSAASMSIVIIHLMAAYANVRIERLFADFINEDSPWYAK 245

  Fly   221 LNVDL--DKVQEI 231
            .:..:  :|::|:
 Worm   246 FDETMTNEKLREM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 21/135 (16%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 15/94 (16%)
cit-1.1NP_001370392.1 CYCLIN_SF 19..160 CDD:424085 26/173 (15%)
CYCLIN_CCNT_rpt2 165..263 CDD:410242 15/94 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.