DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and koko

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_732338.1 Gene:koko / 14462485 FlyBaseID:FBgn0264816 Length:259 Species:Drosophila melanogaster


Alignment Length:265 Identity:51/265 - (19%)
Similarity:97/265 - (36%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DLLRERQH------------DLLALNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKRF 72
            |::..:||            |...:|:.....::||      ....:||::....|.|.:.|.||
  Fly     6 DVMSMQQHVELNKAQTMKPIDYRKMNKPGVVPMYIF------ECAAKLKMKPLTAACAAIVFHRF 64

  Fly    73 YARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYA------------ 125
            :......:.|..|:|...:.||.|::|...:.           |:...:.||.            
  Fly    65 FREVKASDYDEFLIAAGSLYLAGKIKEDESVK-----------IRDVINVAYCTLNRGNDPVDLN 118

  Fly   126 QEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTLSWRIV---------- 180
            .|:....:.|::.|..:...|...|.:...::.||..::.:  :|.:.|..|..|          
  Fly   119 DEYWSMRDAIVQAELLITRTLCFDLNIDLAHKYLLHYMKTL--QDWVGTEVWNSVPIAKAAASYL 181

  Fly   181 NDSLRTDVCLLYPPYQIAIACLQIAC--------VILQKDATKQWFAELNVDLDKVQ--EIVRAI 235
            .|...:...|.|.|..:||.||.:|.        :..:.|.:..|:..|..|..:..  ||:..:
  Fly   182 QDFHHSANILKYKPTHVAIGCLSLALQTYGIQVPLTDESDESAMWYKPLVKDFTRENQWEIIENV 246

  Fly   236 VNLYE 240
            :.:|:
  Fly   247 IEVYK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 22/117 (19%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 22/107 (21%)
kokoNP_732338.1 Cyclin_N 6..144 CDD:278560 28/154 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.