DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and Ccnk

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_033962.2 Gene:Ccnk / 12454 MGIID:1276106 Length:582 Species:Mus musculus


Alignment Length:284 Identity:80/284 - (28%)
Similarity:120/284 - (42%) Gaps:54/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WILDKPDLLR--ERQHDLLALNEDEYQKV---FIFFANVIQVLGEQLKLRQQVIATATVYFKRFY 73
            |..||.||..  .:...|....|..|::.   |||      .:|.:|.|....:||..:||.|||
Mouse    24 WYWDKKDLAHTPSQLEGLDPATEARYRREGARFIF------DVGTRLGLHYDTLATGIIYFHRFY 82

  Fly    74 ARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYAQEF------PYRT 132
            ..:|.|.....:....|:.||.||||        ....|:..|||..|.....:|      |  .
Mouse    83 MFHSFKQFPRYVTGACCLFLAGKVEE--------TPKKCKDIIKTARSLLNDVQFGQFGDDP--K 137

  Fly   133 NHILECEFYLLENLDCCLIVYQPYRPLL----QLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYP 193
            ..::..|..||:.:...|.|..||:.||    ||..|..:..:|:.::|..|||||.|.:.|.:.
Mouse   138 EEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWE 202

  Fly   194 PYQIAIACLQIA---CVI-----LQKDATKQWFAEL--NVDLDKVQEIVRAIVNLYELWKDWKEK 248
            |..||:|.:.:|   |..     ..|...::|:.:.  :|.:|.:::|...|::||...|.    
Mouse   203 PEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQ---- 263

  Fly   249 DEIQM------LLSKIPKPKPPPQ 266
               ||      .|.:.|..:|.||
Mouse   264 ---QMPHHTPHQLQQPPSLQPTPQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 32/114 (28%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 31/104 (30%)
CcnkNP_033962.2 CCL1 25..>217 CDD:227640 62/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.