DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and Ccnc

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001093942.1 Gene:Ccnc / 114839 RGDID:70905 Length:283 Species:Rattus norvegicus


Alignment Length:265 Identity:192/265 - (72%)
Similarity:228/265 - (86%) Gaps:1/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGNFWQSSHSQQWILDKPDLLRERQHDLLALNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATA 65
            ||||||||||..||||||.|||:|||.||..|:|:||.|:.|||.||||.|||.|||||||||||
  Rat     1 MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATA 65

  Fly    66 TVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYAQEFPY 130
            ||||||||||.|||:|||:|:||||:.||||||||||:||:|||:...|.:||:||||:.:||||
  Rat    66 TVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAATTSVLKTRFSYAFPKEFPY 130

  Fly   131 RTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPY 195
            |.||||||||||||.:|||||||.|||||||.||||||||.||.|:||||||:.|||:||||||:
  Rat   131 RMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPLAWRIVNDTYRTDLCLLYPPF 195

  Fly   196 QIAIACLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPK 260
            .||:|||.:|||:.|||| :||||||:||::|:.||:|.|:.|||.||::.|:.|:..:|||:||
  Rat   196 MIALACLHVACVVQQKDA-RQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPK 259

  Fly   261 PKPPP 265
            |||||
  Rat   260 PKPPP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 81/105 (77%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 63/90 (70%)
CcncNP_001093942.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 81/105 (77%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 63/91 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3691
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3803
Inparanoid 1 1.050 389 1.000 Inparanoid score I1935
OMA 1 1.010 - - QHG55499
OrthoDB 1 1.010 - - D1079428at2759
OrthoFinder 1 1.000 - - FOG0003755
OrthoInspector 1 1.000 - - oto98637
orthoMCL 1 0.900 - - OOG6_103590
Panther 1 1.100 - - LDO PTHR10026
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2616
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.