DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycC and Ccnl1

DIOPT Version :9

Sequence 1:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_446114.1 Gene:Ccnl1 / 114121 RGDID:620864 Length:527 Species:Rattus norvegicus


Alignment Length:243 Identity:67/243 - (27%)
Similarity:108/243 - (44%) Gaps:41/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEF------ 100
            |....:||..|..|:|.|..:||..|.|.||:...|.......::|..||.||||:||.      
  Rat    85 ILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRD 149

  Fly   101 ------------GVISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVY 153
                        |..:.|.|| :.|:.|.||             |.:::.|..:|:.|..|:.|.
  Rat   150 VINVFHHLRQLRGKRTPSPLI-LDQNYINTK-------------NQVIKAERRVLKELGFCVHVK 200

  Fly   154 QPYRPLLQLVQ--DMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQ--KDAT 214
            .|::.::..:|  :..:...|:..:|..:||||||:|.:.:.|..||.||:.:|...||  ....
  Rat   201 HPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTR 265

  Fly   215 KQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPKPK 262
            ..||.......:::|||....:.||.     ::|...::|..::.|.|
  Rat   266 PHWFLLFGTTEEEIQEICIETLRLYT-----RKKPNYELLEKEVEKRK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 34/121 (28%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 26/94 (28%)
Ccnl1NP_446114.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
CYCLIN_SF 41..196 CDD:424085 35/124 (28%)
Cyclin-like 1 89..191 32/115 (28%)
CYCLIN_SF 200..322 CDD:424085 30/114 (26%)
Cyclin-like 2 204..288 23/83 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..527
RS 391..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.