DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-C1 and MAS2

DIOPT Version :9

Sequence 1:NP_650401.1 Gene:UQCR-C1 / 41800 FlyBaseID:FBgn0038271 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_011889.1 Gene:MAS2 / 856419 SGDID:S000001066 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:430 Identity:126/430 - (29%)
Similarity:207/430 - (48%) Gaps:36/430 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LQKTLLNIPAT---QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFK 92
            :|:...||..|   :::.|.|||:||:.::....:.:||:||||||.|.....|..|.|:.:|||
Yeast     6 VQRLYSNIARTDNFKLSSLANGLKVATSNTPGHFSALGLYIDAGSRFEGRNLKGCTHILDRLAFK 70

  Fly    93 GTAKRSQTDLELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARE 157
            .|.......:...:|.||.:....:|||..::.|...::||.|.::::::.::..|:.|.|:..:
Yeast    71 STEHVEGRAMAETLELLGGNYQCTSSRENLMYQASVFNQDVGKMLQLMSETVRFPKITEQELQEQ 135

  Fly   158 RSVILREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKADLTDYIQTHYKASRI 222
            :.....|:.||....:.|:.:.||..||.|..||..::.|.:.|.||.|..|.||....|.....
Yeast   136 KLSAEYEIDEVWMKPELVLPELLHTAAYSGETLGSPLICPRELIPSISKYYLLDYRNKFYTPENT 200

  Fly   223 VLAAAGGVKHDDLVKLACSSLGGLEASVLPAEVTPCRFTGSEVRVRD----DSLP-LAHVAIAVE 282
            | ||..||.|:..::|....||..:::..|......::||.|..:..    .:|| |.|:.|..|
Yeast   201 V-AAFVGVPHEKALELTEKYLGDWQSTHPPITKKVAQYTGGESCIPPAPVFGNLPELFHIQIGFE 264

  Fly   283 GCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQ---------SFNTCY 338
            |......|...|....||:|      |||:.:|....:........|...         :||..|
Yeast   265 GLPIDHPDIYALATLQTLLG------GGGSFSAGGPGKGMYSRLYTHVLNQYYFVENCVAFNHSY 323

  Fly   339 KDTGLWGIYFVCDP--------LQCEDMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDG 395
            .|:|::||...|.|        :..:.|......:.:||    ||.||.||||.||:::|:.|:.
Yeast   324 SDSGIFGISLSCIPQAAPQAVEVIAQQMYNTFANKDLRL----TEDEVSRAKNQLKSSLLMNLES 384

  Fly   396 TTPICEDIGRQILCYNRRIPLHELEQRIDAVSVGNVRDVA 435
            .....||:|||:|.:.|:||::|:..:|:.:...::..||
Yeast   385 KLVELEDMGRQVLMHGRKIPVNEMISKIEDLKPDDISRVA 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-C1NP_650401.1 PqqL 35..459 CDD:223685 125/426 (29%)
MAS2NP_011889.1 PqqL 7..457 CDD:223685 126/429 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.