DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-C1 and UQCRC2

DIOPT Version :9

Sequence 1:NP_650401.1 Gene:UQCR-C1 / 41800 FlyBaseID:FBgn0038271 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_003357.2 Gene:UQCRC2 / 7385 HGNCID:12586 Length:453 Species:Homo sapiens


Alignment Length:424 Identity:113/424 - (26%)
Similarity:200/424 - (47%) Gaps:23/424 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTDLELEV 106
            :.|||.|||.:||.::.:..:.:||:|.||||.|:..|.|..|.|...:...|...|...:...:
Human    39 EFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGI 103

  Fly   107 ENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARERSVILREMQEVESN 171
            |.:|..|:...:||...:..:||..||...:|.|.::....:....|:|..:..:..:......|
Human   104 EAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQN 168

  Fly   172 LQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKADLTDYIQTHYKASRIVLAAAGGVKHDDLV 236
            .|..|.::|||.||:.. |...:..|...|..:...:|..::|.|:.::|:.|... ||.|..|.
Human   169 PQTHVIENLHAAAYRNA-LANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGL-GVSHPVLK 231

  Fly   237 KLACSSL---GGLEASVLPAEVTPCRFTGSEVRVRD-DSLPLAHVAIAVEGCGWTDQDNIPLMVA 297
            ::|...|   |||..|...|     .:.|.|:|.:: ||  |.|.|...|.......:.....|.
Human   232 QVAEQFLNMRGGLGLSGAKA-----NYRGGEIREQNGDS--LVHAAFVAESAVAGSAEANAFSVL 289

  Fly   298 NTLVGAWDRSQGGGANNASNLARASAE-DNLCHSFQSFNTCYKDTGLWGIYFVCDPLQCEDMLFN 361
            ..::||....: .|:|..|:|.:|.|: ........:||..|.|:||:|||.:.......|:   
Human   290 QHVLGAGPHVK-RGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDV--- 350

  Fly   362 VQTEWMRLCTM----VTEAEVERAKNLLKTNMLLQLDGTTPICEDIGRQILCYNRRIPLHELEQR 422
            ::..:.::.|:    ::..:|:.|||.||...|:.::.:....|::|.|.|.....:|...:.|:
Human   351 IKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQ 415

  Fly   423 IDAVSVGNVRDVAMKYIYDRCPAVAAVGPVENLP 456
            ||:|:..::.:.|.|::..: .::||.|.:.:.|
Human   416 IDSVANADIINAAKKFVSGQ-KSMAASGNLGHTP 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-C1NP_650401.1 PqqL 35..459 CDD:223685 113/424 (27%)
UQCRC2NP_003357.2 PqqL 37..436 CDD:223685 109/410 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.