DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-C1 and UQCRC1

DIOPT Version :9

Sequence 1:NP_650401.1 Gene:UQCR-C1 / 41800 FlyBaseID:FBgn0038271 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_003356.2 Gene:UQCRC1 / 7384 HGNCID:12585 Length:480 Species:Homo sapiens


Alignment Length:448 Identity:258/448 - (57%)
Similarity:335/448 - (74%) Gaps:5/448 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KSAATLQKTLLNIPATQVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMA 90
            :|.||..:.|..:|.|||:.||||||||||.|...|.|||:|||.|||.|.|||||..:||||:|
Human    33 RSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLA 97

  Fly    91 FKGTAKRSQTDLELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIA 155
            ||||..|..:.||.|||::|||||||::||.|.:|.|.||||:|||||:|.||:||..|.:::|.
Human    98 FKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIE 162

  Fly   156 RERSVILREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKADLTDYIQTHYKAS 220
            :||.||||||||.::::::|||::|||||:|||||.|.:.||::|::.:.:||||:|:.|||||.
Human   163 KERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAP 227

  Fly   221 RIVLAAAGGVKHDDLVKLACSSLGGL----EASVLPAEVTPCRFTGSEVRVRDDSLPLAHVAIAV 281
            |:||||||||:|..|:.||...|||:    ....:|. :|||||||||:|.|||:||.|||||||
Human   228 RMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPT-LTPCRFTGSEIRHRDDALPFAHVAIAV 291

  Fly   282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDTGLWGI 346
            ||.||...||:.|.|||.::|.:|.:.|||.:.:|.||..:..:.||.|||:|:.||.:|||.|.
Human   292 EGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGA 356

  Fly   347 YFVCDPLQCEDMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICEDIGRQILCYN 411
            :||||.::.:||:|.:|.:||||||..||:||.|.||:|:..::..||||||:||||||.:|.|.
Human   357 HFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYG 421

  Fly   412 RRIPLHELEQRIDAVSVGNVRDVAMKYIYDRCPAVAAVGPVENLPDYNRIRSSMYWLR 469
            |||||.|.|.||..|....||::..|||||:|||||..||:|.|||||||||.|:|||
Human   422 RRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLR 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-C1NP_650401.1 PqqL 35..459 CDD:223685 245/427 (57%)
UQCRC1NP_003356.2 PqqL 41..469 CDD:223685 245/428 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0612
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53495
OrthoDB 1 1.010 - - D287307at33208
OrthoFinder 1 1.000 - - FOG0001232
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100777
Panther 1 1.100 - - O PTHR11851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X964
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.