DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-C1 and CG10588

DIOPT Version :9

Sequence 1:NP_650401.1 Gene:UQCR-C1 / 41800 FlyBaseID:FBgn0038271 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster


Alignment Length:381 Identity:84/381 - (22%)
Similarity:154/381 - (40%) Gaps:78/381 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LDNGLRV-----------------------ASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLE 87
            |.||||.                       ::|:.....|...:.:..||.||.::..|:|||:|
  Fly    55 LSNGLRAMLISDSYIDEPSIHRASRESLNSSTENFNGKLAACAVLVGVGSFSEPQQYQGLAHFVE 119

  Fly    88 HMAFKGTAK-RSQTDLELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGE 151
            ||.|.|:.| ..:.:.:..|...|...||:|..|:|.||.:.....:.:.:::..::::...:..
  Fly   120 HMIFMGSEKFPVENEFDSFVTKSGGFSNAHTENEETCFYFELDQTHLDRGMDLFMNLMKAPLMLP 184

  Fly   152 AEIARERSVILREMQEVESNLQEVVFDHLHAT-AYQGTPLGQTILGPTKNIQ------SIGKADL 209
            ..::||||.:..|.::.... .||..|.:.|: |.:|.|.|....|..|.::      |:.| :|
  Fly   185 DAMSRERSAVQSEFEQTHMR-DEVRRDQILASLASEGYPHGTFSWGNYKTLKEGVDDSSLHK-EL 247

  Fly   210 TDYIQTHYKASRIVLAAAGGVKHDDLVKLA---CSSLGGLEASVLPAEVTPCRFTGSEVRVRDDS 271
            ..:.:.||.::|:|:|....:..|:|.:|.   |:.:...:.:.:  :|:...:   :...||..
  Fly   248 HKFYRDHYGSNRMVVALQAQLSLDELEELLVRHCADIPTSQQNSI--DVSQLNY---QKAFRDQF 307

  Fly   272 LPLAHVAIAVEG-C----GWT--DQDNI----PLMVANTLVGAWDRSQGGGA------------N 313
            .....:...||. |    .|.  ...|.    |.|..:.|:|    .:|.|:            :
  Fly   308 YKDVFLVQPVEDVCKLELTWVLPPMKNFYRSKPDMFISQLIG----YEGVGSLCAYLRHHLWCIS 368

  Fly   314 NASNLARASAEDNLCHSFQSFNTCYKDTGLWGIYFVCDPLQCEDMLFNVQTEWMRL 369
            ..:.:|.:|.:.|..:|.  ||.|        ||...|.....|.:......|::|
  Fly   369 VVAGVAESSFDSNSIYSL--FNIC--------IYLSDDGFDHIDEVLEATFAWVKL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-C1NP_650401.1 PqqL 35..459 CDD:223685 84/381 (22%)
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 84/381 (22%)
Peptidase_M16 85..214 CDD:279066 33/129 (26%)
Peptidase_M16_C 244..419 CDD:282978 38/191 (20%)
Peptidase_M16_M 436..720 CDD:292805
Peptidase_M16_C 724..907 CDD:282978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.