DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-C1 and CG3107

DIOPT Version :9

Sequence 1:NP_650401.1 Gene:UQCR-C1 / 41800 FlyBaseID:FBgn0038271 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001036470.1 Gene:CG3107 / 35475 FlyBaseID:FBgn0033005 Length:1034 Species:Drosophila melanogaster


Alignment Length:208 Identity:43/208 - (20%)
Similarity:72/208 - (34%) Gaps:59/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LW-IDAGSRSENEKNN--------------GVAHFLEHMAFKGTAKRSQTDLELEVEN--LGAHL 113
            || ||     .|:.||              |:.|.|||::..|:.|....|...::.|  :...:
  Fly   100 LWHID-----RNDSNNVFSINFRTTPFDSTGLPHILEHLSLCGSQKYPVRDPFFKMLNRSVATFM 159

  Fly   114 NAYTSREQTVFYAKCLSK-DVPKAVEILADIIQNSKLGEAEIARE------------------RS 159
            ||.|..:.|::....::: |......|..|.:....|...:..:|                  :.
  Fly   160 NAMTGPDYTIYPFSTMNEIDFRNLQHIYLDAVFRPNLAYFDFLQEGWRLENKDIFDKQSKLVIKG 224

  Fly   160 VILREM--------QEVESNLQEVVF-DHLHATAYQGTPLGQTILGPTKNIQSIGKADLTDYIQT 215
            |:..||        |....||...:| ||.:.....|.||         .|..:...||.::.:.
  Fly   225 VVYNEMKGAFSENAQVFSQNLLNNIFPDHTYRHVSGGNPL---------EIPKLAYNDLVEFHKK 280

  Fly   216 HYKASRIVLAAAG 228
            :|..|...:.:.|
  Fly   281 YYHPSNARIYSYG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-C1NP_650401.1 PqqL 35..459 CDD:223685 43/208 (21%)
CG3107NP_001036470.1 Cym1 68..1003 CDD:223957 43/208 (21%)
Peptidase_M16 120..>177 CDD:279066 13/56 (23%)
Peptidase_M16_C 268..457 CDD:282978 5/26 (19%)
M16C_assoc 531..773 CDD:285556
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.