DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-C1 and Nrd1

DIOPT Version :9

Sequence 1:NP_650401.1 Gene:UQCR-C1 / 41800 FlyBaseID:FBgn0038271 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_572757.2 Gene:Nrd1 / 32143 FlyBaseID:FBgn0030344 Length:1147 Species:Drosophila melanogaster


Alignment Length:231 Identity:61/231 - (26%)
Similarity:111/231 - (48%) Gaps:11/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KSAATLQKTLLN-IPATQVTKLD--NGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLE 87
            ||..:...:::: ..:|..|..|  :....:||:.....|...|.||.||.:|..|..|:|||||
  Fly    97 KSTVSTSSSIISRSESTSSTSTDSESSEESSSEEGDEKLAACALLIDYGSFAEPTKYQGLAHFLE 161

  Fly    88 HMAFKGTAKRSQTDL-ELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGE 151
            ||.|.|:.|..:.:: :..::..|...||.|..|.|:||.:...|.:..:::....:::...:.:
  Fly   162 HMIFMGSEKYPKENIFDAHIKKCGGFANANTDCEDTLFYFEVAEKHLDSSLDYFTALMKAPLMKQ 226

  Fly   152 AEIARERSVILREMQEVESNLQEVVFDHLHAT-AYQGTPLGQTILGPTKNI-QSIGKADLTDYI- 213
            ..:.||||.:..|.|::..: .|...|.|.|: |.:|.|.|....|..|:: :::..|:|...: 
  Fly   227 EAMQRERSAVDSEFQQILQD-DETRRDQLLASLATKGFPHGTFAWGNMKSLKENVDDAELHKILH 290

  Fly   214 ---QTHYKASRIVLAAAGGVKHDDLVKLACSSLGGL 246
               :.||.|:|:.:.....:..|:|..|......|:
  Fly   291 EIRKEHYGANRMYVCLQARLPIDELESLVVRHFSGI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-C1NP_650401.1 PqqL 35..459 CDD:223685 59/222 (27%)
Nrd1NP_572757.2 Ptr 54..1023 CDD:223956 61/231 (26%)
Peptidase_M16 136..246 CDD:279066 34/109 (31%)
Peptidase_M16_C 289..472 CDD:282978 8/38 (21%)
Peptidase_M16_M 478..766 CDD:292805
Peptidase_M16_C 769..953 CDD:282978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.