DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and Samd7

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_083765.2 Gene:Samd7 / 75953 MGIID:1923203 Length:445 Species:Mus musculus


Alignment Length:101 Identity:23/101 - (22%)
Similarity:36/101 - (35%) Gaps:11/101 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LENMIRHKMRHLKPNYLNRNPRFFMFRNKLLKNYKAAPYENASVLWDIANWWPHENEVYPLYDSS 107
            ::|..:.::...||..:..||      :..|..::..|....:..||.....|.| :||...|..
Mouse   234 VDNQQKPRVADGKPTTVPANP------HGELHTHQRKPSSLEANAWDDGKGKPSE-QVYEGCDGK 291

  Fly   108 MGQLLETLRREPITRVSNLGRGTQLKLLVRLSHQQK 143
            .|    ..|...|..:|.......|:....||..||
Mouse   292 NG----VFRPVSILPLSGTHEQVALRENCSLSDIQK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333
Samd7NP_083765.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..282 10/53 (19%)
SAM_Samd7,11 321..388 CDD:188978 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.