DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and FAM20C

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_016867939.1 Gene:FAM20C / 56975 HGNCID:22140 Length:671 Species:Homo sapiens


Alignment Length:462 Identity:145/462 - (31%)
Similarity:220/462 - (47%) Gaps:82/462 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ALGANFYFMYYLSAEEGHLASVRALENMIRHKMRHLKPN----YLNRNPRFFMFRNKLLKN--YK 77
            |.||.|     ||..|   |:|.:..|.::.   |:..|    |...||......:.|...  ..
Human   207 AEGAEF-----LSPGE---AAVDSYPNWLKF---HIGINRYELYSRHNPAIEALLHDLSSQRITS 260

  Fly    78 AAPYENASVLWD-IANWW-------------------PHENEVYPLYDSSMGQLLETLRREP--- 119
            .|.:...|.:.| ::.||                   |.:.....:.|....:.|::..|:|   
Human   261 VADFTGTSCMSDPLSGWWGVEDEFSLNEICCLCGPDSPRKRHTRTVPDPEEERALQSRARQPGRV 325

  Fly   120 ---------------ITRVSNL----GRGTQLKLLVRLSHQQKVIFKPQWYPREEVI--DGMIYS 163
                           :.|.:.|    ..||||||::...:..:.:|||....||:..  |...:|
Human   326 ERRGLHWEGLRTFHRVCRAAYLPAMKSGGTQLKLIMTFQNYGQALFKPMKQTREQETPPDFFYFS 390

  Fly   164 GKDRHTAEVYAFYLGAVLDFRWTPIVVGRVVNLKKEIY-AKGDPELQQTINIETDEDGREKYCLF 227
            ..:||.||:.||:|..:||||..|.|.||:||:.|||. ...|.:|.:|..|..    ....|.:
Human   391 DYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLWRTFFISP----ANNICFY 451

  Fly   228 GKC-HYCNEEETVCGDERHNIEGVLIYIVPG-TLAKR---RSPWQRTYKDDKRAPWEDDMTYCKS 287
            |:| :||:.|..:|| :...|||.|...:|. :||||   |:||:|:|...|:|.||.|..||:.
Human   452 GECSYYCSTEHALCG-KPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEE 515

  Fly   288 LKNKM---ETIRLLDLIDASIFDYLIQNGDRHHYET-----REERVVLIDNGKAFGNPNKDHLDI 344
            :|...   .:.|:||::|.:|||:|:.|.|||||||     .|..::.:|||:.||..:.|.|.|
Human   516 VKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSI 580

  Fly   345 LAPLYQCCLLRKSTWDRLQVFSGG--VLTEIIDRLSKQDALYPLITDKHKKGVERRLLVVYAVVE 407
            |.||.|||.:||||:.|||:.:..  .|:.::....:.|.:.|::...|.:.::|||.||...|.
Human   581 LVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVR 645

  Fly   408 HCMDIEG 414
            .|::..|
Human   646 DCVERNG 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 79/204 (39%)
FAM20CXP_016867939.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.