DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and FAM20A

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_060035.2 Gene:FAM20A / 54757 HGNCID:23015 Length:541 Species:Homo sapiens


Alignment Length:424 Identity:133/424 - (31%)
Similarity:204/424 - (48%) Gaps:51/424 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSAEEGHLASVRALENMIRHKMRHLKPNYLNRNPRFFMFRNKLLKNYKAAPYE-NASVLWDIANW 93
            |.||:..|||..||        |:.:......|.|..|:|.::.......|.: .....|...:.
Human   110 LGAEDSLLASQEAL--------RYYRRKVARWNRRHKMYREQMNLTSLDPPLQLRLEASWVQFHL 166

  Fly    94 WPHENEVYPLYDSSMGQLLETLRREPITRV-------SNLG----------RGTQLKLLVRLSHQ 141
            ..:.:.:|......:.:||:.:|..|....       :.||          .|..|||::|.|..
Human   167 GINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF 231

  Fly   142 QKVIFKPQWYPREE--VIDGMIYSGKDRHTAEVYAFYLGAVLDFRWTPIVVGRVVNLKKEIYAKG 204
            .|.:|||....|:|  .:|...:....||.||:.||:|..:||||..|..|||:||:.|||....
Human   232 GKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRIVNVTKEILEVT 296

  Fly   205 DPELQQTINIETDEDGREKYCLFGKCHY-CNEEETVCGDERHNIEGVLIYIVPG-TLAKRRS--- 264
            ..|:.|::...:.   ....|.|.||.| |..|..|||:. |.:||.|...:|. .||.|.|   
Human   297 KNEILQSVFFVSP---ASNVCFFAKCPYMCKTEYAVCGNP-HLLEGSLSAFLPSLNLAPRLSVPN 357

  Fly   265 PWQRTYKDDKRAPWEDDMTYCKSLK-----NKMETIRLLDLIDASIFDYLIQNGDRHHYE--TR- 321
            ||.|:|....:..||.:..||.::|     |..:  |||::||.:|||:||.|.||||||  |: 
Human   358 PWIRSYTLAGKEEWEVNPLYCDTVKQIYPYNNSQ--RLLNVIDMAIFDFLIGNMDRHHYEMFTKF 420

  Fly   322 --EERVVLIDNGKAFGNPNKDHLDILAPLYQCCLLRKSTWDRLQVFSGG--VLTEIIDRLSKQDA 382
              :..::.:||.:.||..:.|.:.||:||.|||:::|.|...||:.:..  .|::::.....:|.
Human   421 GDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQ 485

  Fly   383 LYPLITDKHKKGVERRLLVVYAVVEHCMDIEGDK 416
            |.|::|:.|...::|||..:...||.|:...|.:
Human   486 LSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQ 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 75/206 (36%)
FAM20ANP_060035.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..90
FAM20A_C 306..522 CDD:198460 76/220 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.