DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and CG31145

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster


Alignment Length:343 Identity:111/343 - (32%)
Similarity:178/343 - (51%) Gaps:28/343 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ENEVYPLYDSSMGQLLETLRREPITRVSNLGRGTQLKLLVRLSHQQKVIFKPQWYPREE--VIDG 159
            :.|:|...|:.:..:|..:.:.||..|.....||||||::...:..|.:.||..:|||:  :.:.
  Fly   638 KKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQQTLPNH 702

  Fly   160 MIYSGKDRHTAEVYAFYLGAVLDFRWTPIVVGRVVNLKKEIYAKGDPELQQTINIETDEDGREKY 224
            ..::..:||.||:.||:|..:|.||....|.||.:|:..|||...:..|.:|..:....:    .
  Fly   703 FYFTDYERHNAEIAAFHLDRILGFRRAMPVAGRTLNITTEIYQLAEENLLKTFFVSPSLN----L 763

  Fly   225 CLFGKC-HYCNEEETVCGDERHNIEGVLIYIVP----GTLAKRRSPWQRTYKDDKRAPWEDDMTY 284
            |..||| :||:....:||:. ..:||.....:|    |.....|.||:|:|...|:|.||.|..|
  Fly   764 CFHGKCSYYCDTSHAICGNP-DMLEGSFAAFLPNFESGNRKLWRHPWRRSYHKRKKAQWETDANY 827

  Fly   285 C---KSLKNKMETIRLLDLIDASIFDYLIQNGDRHHYET-----REERVVLIDNGKAFGNPNKDH 341
            |   :.:....:..||.||:|.::||:|..|.|||||||     .|...:.:|:|:.||.|..|.
  Fly   828 CALVRDIPPYDDGRRLYDLMDMAVFDFLTGNMDRHHYETFKVYGNETFPLHLDHGRGFGRPFHDE 892

  Fly   342 LDILAPLYQCCLLRKSTWDRLQVFSGG--VLTEIIDRLSKQDALYPLITDKHKKGVERRLLVVYA 404
            |.||||:.||||:||||..:|..|..|  .|::::.....||.:.|::...|.:.::||..::..
  Fly   893 LSILAPVLQCCLIRKSTLVKLLDFHNGPKPLSQLMSESLSQDPVSPVLWQPHLEALDRRTGIILQ 957

  Fly   405 VVEHCM------DIEGDK 416
            .:..|:      |::|.:
  Fly   958 SIRDCIKRNPPGDVDGSE 975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 72/210 (34%)
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477 71/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450143
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12450
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.