DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and fam20b

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_989211.1 Gene:fam20b / 394819 XenbaseID:XB-GENE-1005213 Length:409 Species:Xenopus tropicalis


Alignment Length:333 Identity:139/333 - (41%)
Similarity:194/333 - (58%) Gaps:16/333 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 WDIANWWPHENEVYPLYDSSMGQLLETLRREPITRVSNLGRGTQLKLLVRLSHQQKVIFKPQWYP 152
            |:||:.|....||||.....||.:|.::..:.|.:.....:|||||.|:.|...|||:|||:.|.
 Frog    64 WEIASQWVVPREVYPEDSPEMGAVLHSMATKKIVKADVGYKGTQLKALLVLEGGQKVVFKPKRYS 128

  Fly   153 REEVIDGMIYSGKDRHTAEVYAFYLGAVLDFRWTPIVVGRVVNLKKEIYAKGDPELQQTINIETD 217
            |:.:::|..|:|.|||.|||.||:|..:|.||..|:||||.|||..||......:|..|...:.:
 Frog   129 RDYIVEGEPYAGYDRHNAEVTAFHLDRILGFRRAPLVVGRYVNLITEIKPVATEQLLSTFLKQGN 193

  Fly   218 EDGREKYCLFGKCHYCNEEETVCGDERHNIEGVLIYIVPGT--LAKRRSPWQRTYKDDKRAPWED 280
            ..     |.:|||:||.|.|..|. ||..:||.:...:|..  |.|.|.||.|||::.|.|.||.
 Frog   194 NT-----CFYGKCYYCRETEPACA-ERELMEGTVTLWLPEAWPLQKHRHPWGRTYREGKLARWEY 252

  Fly   281 DMTYCKSLKNKM---ETIRLLDLIDASIFDYLIQNGDRHHYETREE-----RVVLIDNGKAFGNP 337
            |.:||.::|...   ...||||:||.:|||:||.|.||||||:.::     .::|:||.|:||||
 Frog   253 DESYCDAVKKTSPYDSGPRLLDVIDTAIFDFLIGNADRHHYESFQDDEGGSMLILLDNAKSFGNP 317

  Fly   338 NKDHLDILAPLYQCCLLRKSTWDRLQVFSGGVLTEIIDRLSKQDALYPLITDKHKKGVERRLLVV 402
            ..|...|||||||||::|.|||:||.....|.|...:...:..|.:.|:::|.|...:||||..:
 Frog   318 LVDERSILAPLYQCCIIRVSTWNRLSHLKHGTLRSALLTATAHDPISPVLSDAHLDALERRLQSI 382

  Fly   403 YAVVEHCM 410
            .|.|:.|:
 Frog   383 LATVQQCI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 85/197 (43%)
fam20bNP_989211.1 FAM20B_C 188..394 CDD:198461 85/209 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6809
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8909
Inparanoid 1 1.050 257 1.000 Inparanoid score I3068
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 1 1.000 - - FOG0008106
OrthoInspector 1 1.000 - - oto104748
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6056
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.