DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and SAMD7

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001291295.1 Gene:SAMD7 / 344658 HGNCID:25394 Length:446 Species:Homo sapiens


Alignment Length:218 Identity:39/218 - (17%)
Similarity:63/218 - (28%) Gaps:97/218 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FRNKLLKNYKAAPYENASVLWDIANWWPHENEVYPLYDSSMGQLLETLRREPITRVSNLGRGTQL 132
            |....|:|.:..|...|:.        ||       ::.|.||....||:       |.|     
Human   152 FHRSTLRNLQGNPMLAATA--------PH-------FEESWGQRCRRLRK-------NTG----- 189

  Fly   133 KLLVRLSHQQKVIFKPQWYPREEVIDGMIYSGKDRHTAEVYAFYLGAVLDFRWTPIVVGRVVNLK 197
                                .::.:|....|.|.:...::    ||..           ..|..:
Human   190 --------------------NQKALDSDAESSKSQAEEKI----LGQT-----------HAVPYE 219

  Fly   198 KEIYAKGDPELQQTINIETDEDGREKYCLFGKCHYCNEEET-----VCGDERHNIEGVLIYIVPG 257
            ::.||| ||:::...|.::.|              .||:.|     .||:           :.| 
Human   220 EDHYAK-DPDIEAPSNQKSSE--------------TNEKPTTALANTCGE-----------LEP- 257

  Fly   258 TLAKRRSPWQRTYKDDKRAPWED 280
               ..|.||.......|...|:|
Human   258 ---THRKPWGSHTTTLKAKAWDD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 12/62 (19%)
SAMD7NP_001291295.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..207 5/44 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..277 16/81 (20%)
SAM_Samd7,11 324..391 CDD:188978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.