DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and Samd7

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001178632.1 Gene:Samd7 / 310257 RGDID:1308931 Length:445 Species:Rattus norvegicus


Alignment Length:35 Identity:11/35 - (31%)
Similarity:16/35 - (45%) Gaps:9/35 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 DRLQVFSGGVLTEIIDRLSKQDALYPLITDKHKKG 394
            |..|||.        |.....:.| ||:|::|.:|
  Rat   341 DYAQVFK--------DHAIDGETL-PLLTEQHLRG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 11/35 (31%)
Samd7NP_001178632.1 SAM_Samd7,11 321..388 CDD:188978 11/35 (31%)
SAM 322..384 CDD:197735 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.