DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and Fam20a

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_722477.1 Gene:Fam20a / 208659 MGIID:2388266 Length:541 Species:Mus musculus


Alignment Length:435 Identity:134/435 - (30%)
Similarity:207/435 - (47%) Gaps:73/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSAEEGHLASVRALE---------NMIRHKMRHLKPNYLNRNPRFFMFRNKLLKNYKAAPYENAS 85
            |..|:..|||..||.         |. |||:...:.|..:.:|. ..||.:              
Mouse   110 LGPEDWLLASQEALRYYRRKVARWNR-RHKIYKEQFNLTSLDPP-LQFRPE-------------- 158

  Fly    86 VLWDIANWWP-----HENEVYPLYDSSMGQLLETLRREPITRV-------SNLG----------R 128
                 |:|..     :.:.:|.....::.:||..:|..|....       :.||          .
Mouse   159 -----ASWVQFHLGINSHGLYSRSSLAISKLLHDMRHFPTISADYSQDEKALLGACDCSQIVKPS 218

  Fly   129 GTQLKLLVRLSHQQKVIFKPQWYPREEVI--DGMIYSGKDRHTAEVYAFYLGAVLDFRWTPIVVG 191
            |..|||::|.|...|.:|||....|||..  |...:....||.||:.||:|..:||||..|..||
Mouse   219 GVHLKLVLRFSDFGKAMFKPMRQQREEETPEDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVG 283

  Fly   192 RVVNLKKEIYAKGDPELQQTINIETDEDGREKYCLFGKCHY-CNEEETVCGDERHNIEGVLIYIV 255
            |:||:.|||......|:.|::...:..:   ..|.|.||.| |..|..|||:. |.:||.|...:
Mouse   284 RLVNVTKEILEVTKNEILQSVFFVSPAN---NVCFFAKCPYMCKTEYAVCGNP-HLLEGSLSAFL 344

  Fly   256 PG-TLAKRRS---PWQRTYKDDKRAPWEDDMTYCKSLKN---KMETIRLLDLIDASIFDYLIQNG 313
            |. .||.|.|   ||.|:|....:..||.:..||.::|.   ...:.|||.:||.::||:||.|.
Mouse   345 PSLNLAPRLSVPNPWIRSYSLSGKEEWELNPLYCDTVKQIYPYNSSNRLLGIIDMAVFDFLIGNM 409

  Fly   314 DRHHYE--TR---EERVVLIDNGKAFGNPNKDHLDILAPLYQCCLLRKSTWDRLQVFSGG--VLT 371
            ||||||  |:   :..::.:||.:.||..::|.:.|||||.|||::::.|...||:.:..  .|:
Mouse   410 DRHHYEMFTKFGDDGYLIHLDNARGFGRHSQDEISILAPLAQCCMIKRKTLLHLQLLAQADYRLS 474

  Fly   372 EIIDRLSKQDALYPLITDKHKKGVERRLLVVYAVVEHCMDIEGDK 416
            :::.....:|.|.|::|:.|...::|||.::...||.|::..|::
Mouse   475 DVMRESLLEDQLSPVLTEPHLLALDRRLQIILKTVEDCIEAHGER 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 73/204 (36%)
Fam20aNP_722477.1 FAM20_C_like 306..522 CDD:297333 74/218 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.